| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 40-c-58-b-110-c-95 | 26-b-84 |
Chain Sequence |
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
|
| sequence length |
124
|
| structure length |
124
|
| publication title |
Triazole pyrimidine nucleosides as inhibitors of Ribonuclease A. Synthesis, biochemical, and structural evaluation.
pubmed doi rcsb |
| molecule tags |
Hydrolase/hydrolase inhibitor
|
| molecule keywords |
Ribonuclease pancreatic
|
| ec nomenclature |
ec
3.1.27.5: Pancreatic ribonuclease. |
| pdb deposition date | 2012-07-23 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
