| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 25-253 | 229 | 1-24, 254-257 | 24 | 4 | knot |
Chain Sequence |
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECITWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 24-252 | 229 | 1-23, 253-257 | 23 | 5 | knot |
| sequence length |
257
|
| structure length |
257
|
| publication title |
Anionic binding in HCAII: tetrahedral complex formation with cyanate at the zinc
rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 2
|
| source organism |
Homo sapiens
|
| ec nomenclature |
ec
4.2.1.1: Carbonate dehydratase. |
| pdb deposition date | 2012-08-06 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
