| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 50-c-54-b-97-c-95 | 19-b-61 |
Chain Sequence |
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
|
| sequence length |
95
|
| structure length |
95
|
| publication title |
Chemical synthesis and X-ray structure of a heterochiral {D-protein antagonist plus vascular endothelial growth factor} protein complex by racemic crystallography.
pubmed doi rcsb |
| molecule tags |
Growth factor/inhibitor
|
| molecule keywords |
D- Vascular endothelial growth factor-A
|
| ec nomenclature | |
| pdb deposition date | 2012-08-14 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
