4HMKA

Crystal structure of leut-e290s with bound br
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 202
Slipknot S +31 41 +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 38-264 227 265-509 1-21 22-37 21 244 slipknot
view details
41 14-294 281 1-13 350-509 295-349 13 160 slipknot
Chain Sequence
KREHWATRLGLILAMAGNAVGLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAIKFLVGLVPEPP---TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKLKDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKASVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWAGTIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYEET-----HWTVWITRFYIIGLFLFLTFLVFLAERRRNHES
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 11-286 276 1-10 301-501 287-300 10 201 slipknot
view details
3.2 19-335 317 1-18 349-501 336-348 18 153 slipknot
view details
4.1 12-300 289 1-2, 308-501 3-11, 301-307 2 194 slipknot
view details
3.2 8-316 309 1-2, 323-501 3-7, 317-322 2 179 slipknot
view details
3.2 13-327 315 1-4, 334-501 5-12, 328-333 4 168 slipknot
view details
4.1 12-309 298 1-5, 315-501 6-11, 310-314 5 187 slipknot
view details
1.1 26-278 253 1-16, 289-501 17-25, 279-288 16 213 slipknot
view details
2.1 26-414 389 1-18, 432-501 19-25, 415-431 18 70 slipknot
view details
2.1 34-257 224 1-21, 276-501 22-33, 258-275 21 226 slipknot
view details
1.1 41-243 203 1-22, 256-501 23-40, 244-255 22 246 slipknot
view details
2.1 28-275 248 1-22, 282-501 23-27, 276-281 22 220 slipknot
view details
1.1 39-278 240 1-26, 292-501 27-38, 279-291 26 210 slipknot
view details
1.1 35-272 238 1-28, 279-501 29-34, 273-278 28 223 slipknot
view details
1.1 43-260 218 1-35, 275-501 36-42, 261-274 35 227 slipknot
view details
2.1 42-399 358 1-35, 405-501 36-41, 400-404 35 97 slipknot
sequence length 509
structure length 501
publication title The chloride binding site of Neurotransmitter Sodium Symporters
rcsb
molecule tags Membrane protein
molecule keywords Transporter
source organism Aquifex aeolicus
missing residues 129-131, 469-473
total genus Genus: 202
ec nomenclature
pdb deposition date 2012-10-18
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00209 SNF Sodium:neurotransmitter symporter family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling