4HMKA

Crystal structure of leut-e290s with bound br
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Slipknot S +31 41 +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 38-264 227 265-509 1-21 22-37 21 244 slipknot
view details
41 14-294 281 1-13 350-509 295-349 13 160 slipknot
Chain Sequence
KREHWATRLGLILAMAGNAVGLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAIKFLVGLVPEPP---TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKLKDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKASVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWAGTIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYEET-----HWTVWITRFYIIGLFLFLTFLVFLAERRRNHES
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 11-286 276 1-10 301-501 287-300 10 201 slipknot
view details
3.2 19-335 317 1-18 349-501 336-348 18 153 slipknot
view details
4.1 12-300 289 1-2, 308-501 3-11, 301-307 2 194 slipknot
view details
3.2 8-316 309 1-2, 323-501 3-7, 317-322 2 179 slipknot
view details
3.2 13-327 315 1-4, 334-501 5-12, 328-333 4 168 slipknot
view details
4.1 12-309 298 1-5, 315-501 6-11, 310-314 5 187 slipknot
view details
1.1 26-278 253 1-16, 289-501 17-25, 279-288 16 213 slipknot
view details
2.1 26-414 389 1-18, 432-501 19-25, 415-431 18 70 slipknot
view details
2.1 34-257 224 1-21, 276-501 22-33, 258-275 21 226 slipknot
view details
1.1 41-243 203 1-22, 256-501 23-40, 244-255 22 246 slipknot
view details
2.1 28-275 248 1-22, 282-501 23-27, 276-281 22 220 slipknot
view details
1.1 39-278 240 1-26, 292-501 27-38, 279-291 26 210 slipknot
view details
1.1 35-272 238 1-28, 279-501 29-34, 273-278 28 223 slipknot
view details
1.1 43-260 218 1-35, 275-501 36-42, 261-274 35 227 slipknot
view details
2.1 42-399 358 1-35, 405-501 36-41, 400-404 35 97 slipknot
missing residues 129-131, 469-473
publication title The chloride binding site of Neurotransmitter Sodium Symporters
rcsb
structure length 501
molecule tags Membrane protein
source organism Aquifex aeolicus
sequence length 509
total genus Genus: 202
molecule keywords Transporter
ec nomenclature
pdb deposition date 2012-10-18
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00209 SNF Sodium:neurotransmitter symporter family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling