| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 3-c-16-b-44-c-23 | 3-b-16 |
Chain Sequence |
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRP
|
| sequence length |
73
|
| structure length |
73
|
| publication title |
Structural principles for Alpha-neurotoxin binding to and selectivity among nicotinic receptors
rcsb |
| molecule tags |
Protein binding
|
| molecule keywords |
Alpha7 nicotinic receptor chimera
|
| source organism |
Homo sapiens, lymnaea stagnalis
|
| ec nomenclature | |
| pdb deposition date | 2012-10-25 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
