4J3CA

Crystal structure of 16s ribosomal rna methyltransferase rsme
Warning
  • Chain breaks within knotoid 52 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knotoid 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 161-210 50 1-160, 211-239 160 29 knot
Chain Sequence
MQRLFIENALHAGAKHEATREQF----NVLRLGEGSSLLVFNGRDGEWRAEIAMPSRQAVL-VAVEQTRPQPAPCDLVYLFAPLKVGRLDYLVQKAVEMGAGVLQPVMTQHVQGKIGSLERVRANVIEAAEQCGVLGIPAVEEPRKLEDLLIDWPRDRRIVFCDEGSQNPL--PILEGIAERRLALLIGPEGGFSEAERDLLRSRDFVTAIPLGPRILRADTAAVAAMAVIQATLGDWR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 144-205 62 1-143, 206-232 143 27 knot
view details
3.1 153-205 53 206-232 1-143 144-152 143 26 slipknot
view details
3.1 155-205 51 1-152, 229-232 153-154, 206-228 152 4 slipknot
view details
3.1 156-207 52 1-154, 232-232 155-155, 208-231 154 1 slipknot
sequence length 239
structure length 232
publication title Crystal structure of 16S ribosomal RNA methyltransferase RsmE
rcsb
molecule tags Transferase
molecule keywords Ribosomal RNA small subunit methyltransferase E
source organism Sinorhizobium meliloti
missing residues 24-27, 58, 167-168
total genus Genus: 55
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2013-02-05
KnotProt deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling