Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 79-120 | 42 | 1-78, 121-155 | 78 | 35 | knot |
Chain Sequence |
MALNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLGYPGAV
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 78-121 | 44 | 1-77, 122-155 | 77 | 34 | knot | ||||
view details |
![]() |
2.1 | 75-118 | 44 | 1-74 | 124-155 | 119-123 | 74 | 32 | slipknot | ||
view details |
![]() |
3.1 | 80-130 | 51 | 1-77, 141-155 | 78-79, 131-140 | 77 | 15 | slipknot | |||
view details |
![]() |
3.1 | 81-138 | 58 | 139-155 | 1-77 | 78-80 | 77 | 16 | slipknot |
sequence length |
155
|
structure length |
155
|
publication title |
The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL
pubmed doi rcsb |
molecule tags |
Transferase
|
molecule keywords |
tRNA (cytidine(34)-2'-O)-methyltransferase
|
source organism |
Escherichia coli
|
total genus |
![]() |
ec nomenclature |
ec
2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase. |
pdb deposition date | 2013-02-18 |
KnotProt deposition date | 2014-07-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00588 | SpoU_methylase | SpoU rRNA Methylase family |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...