| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 78-120 | 43 | 1-77, 121-156 | 77 | 36 | knot |
Chain Sequence |
MALNIVLYEPEIPPNTGNIIRLCANTGFRLHIIEPMGFAWDDKRLRRAGLDYHEFTAVTRHHDYRAFLEAENPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPAEQKIRIPMVPDSRSMNLSNAVSVVVYEAWRQLGYPGAVL
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
3.1 | 78-122 | 45 | 1-77, 123-156 | 77 | 34 | knot | ||||
| view details |
|
2.1 | 77-118 | 42 | 1-76 | 124-156 | 119-123 | 76 | 33 | slipknot | ||
| view details |
|
2.1 | 81-123 | 43 | 124-156 | 1-77 | 78-80 | 77 | 32 | slipknot |
| sequence length |
156
|
| structure length |
156
|
| publication title |
The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL
pubmed doi rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
tRNA (cytidine(34)-2'-O)-methyltransferase
|
| source organism |
Escherichia coli
|
| total genus |
Genus: 48
|
| ec nomenclature |
ec
2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase. |
| pdb deposition date | 2013-02-18 |
| KnotProt deposition date | 2014-08-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00588 | SpoU_methylase | SpoU rRNA Methylase family |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...