4JPHD

Crystal structure of protein related to dan and cerberus (prdc)
Cysteine knot
Loop Piercing
view details
73-c-87-b-137-c-123 97-b-155
Chain Sequence
KEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEDSFQSCAFCKPQRVTSVIVELECPGLDPPFRIKKIQKVKHCRCMSV
sequence length 111
structure length 111
publication title Structure of protein related to dan and cerberus: insights into the mechanism of bone morphogenetic protein antagonism.
pubmed doi rcsb
molecule tags Cytokine
molecule keywords Gremlin-2
source organism Mus musculus
ec nomenclature
pdb deposition date 2013-03-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling