4JSSA

Human carbonic anhydrase ii h94d bound to a bidentate inhibitor
Genus: 76
Alphaknot: P00918
Slipknot S +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 23-254 232 1-22, 255-258 22 4 knot
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFDFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 11x +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 22-255 234 1-21, 256-258 21 3 knot
Fingerprint Knot forming loop Loop type
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His96 ...
Chain closureLys261 <-> His4
 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His4		 probabilistic
K +31 His4 ... His96 <->
Bridging ionZn301
<-> His119 ...
Chain closureLys261 <-> His4
 probabilistic
K +31 His4 ... Asp94 <->
Bridging ionZn301
<-> His119 ...
Chain closureLys261 <-> His4
 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Glu205 <->
Bridging ionMbo302
<-> Gln137 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His96 <->
Bridging ionZn301
<-> Asp94 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His119 <->
Bridging ionZn301
<-> His96 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Cys206 <->
Bridging ionMbo302
<-> Gln137 ... His119 <->
Bridging ionZn301
<-> Asp94 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Glu205 <->
Bridging ionMbo302
<-> Gln137 ... His96 <->
Bridging ionZn301
<-> Asp94 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Glu205 <->
Bridging ionMbo302
<-> Gln137 ... His119 <->
Bridging ionZn301
<-> His96 ... His4		 probabilistic
K +31
Chain closureHis4 <-> Lys261
... Glu205 <->
Bridging ionMbo302
<-> Gln137 ... His119 <->
Bridging ionZn301
<-> Asp94 ... His4		 probabilistic
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFDFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 26-256 231 1-25, 257-257 25 1 knot
view details
2.1 24-251 228 1-23 257-257 252-256 23 1 slipknot
sequence length 257
structure length 257
publication title Metalloprotein-Inhibitor Binding: Human Carbonic Anhydrase II as a Model for Probing Metal-Ligand Interactions in a Metalloprotein Active Site.
pubmed doi rcsb
molecule tags Lyase/lyase inhibitor
molecule keywords Carbonic anhydrase 2
source organism Homo sapiens
total genus Genus: 76
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2013-03-22
KnotProt deposition date 2018-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
1CA3A 1CNWA 1CNXA 1CNYA 1CVCA 1EOUA 1G6VA 4JSAA 4JSSA
similar chains in the KnotProt database (40% sequence similarity)
None
similar chains in the pdb database (40% sequence similarity)

  
#similar chains in the KnotProt database (40% sequence similarity)
1CA3 A; 1CNW A; 1CNX A; 1CNY A; 1CVC A; 1EOU A; 1G6V A; 4JSA A; 4JSS A; 
#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.