| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 7-c-13-b-33-c-28 | 17-b-33 |
Chain Sequence |
EFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS
|
| sequence length |
37
|
| structure length |
37
|
| publication title |
Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K(+) channel.
pubmed doi rcsb |
| molecule tags |
Transport protein/toxin
|
| molecule keywords |
Voltage-gated potassium channel subunit beta-2
|
| source organism |
Rattus norvegicus
|
| ec nomenclature | |
| pdb deposition date | 2013-03-23 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
