4JWFA

Crystal structure of sptrm10(74)-sah complex
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 100-143 44 1-99, 144-187 99 44 knot
Chain Sequence
RIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIKITDRKILTVNQVFEILSLWLEYRDWEKAFMEVIP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 100-145 46 1-99, 146-187 99 42 knot
view details
2.1 98-142 45 1-97 147-187 143-146 97 41 slipknot
view details
3.1 101-158 58 1-99, 177-187 100-100, 159-176 99 11 slipknot
view details
3.1 102-160 59 1-100, 177-187 101-101, 161-176 100 11 slipknot
view details
2.1 102-176 75 1-99, 182-187 100-101, 177-181 99 6 slipknot
view details
3.1 102-181 80 182-187 1-99 100-101 99 5 slipknot
publication title Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb
structure length 187
molecule tags Transferase
source organism Schizosaccharomyces pombe
sequence length 187
total genus Genus: 61
molecule keywords tRNA (guanine(9)-N1)-methyltransferase
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2013-03-27
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling