4JWHA

Crystal structure of sptrm10(full length)-sah complex
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 100-144 45 1-99, 145-189 99 45 knot
Chain Sequence
RIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIK----KILTVNQVFEILSLWLEYRDWEKAFMEVIPKR
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 99-144 46 1-98, 145-185 98 41 knot
view details
2.1 97-141 45 1-96 147-185 142-146 96 39 slipknot
view details
3.1 100-145 46 146-185 1-98 99-99 98 39 slipknot
view details
3.1 101-157 57 1-99, 172-185 100-100, 158-171 99 14 slipknot
view details
2.1 101-171 71 1-99, 178-185 100-100, 172-177 99 8 slipknot
view details
3.1 102-157 56 1-100, 172-185 101-101, 158-171 100 14 slipknot
view details
3.1 102-171 70 1-100, 178-185 101-101, 172-177 100 8 slipknot
missing residues 154-157
publication title Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb
structure length 185
molecule tags Transferase
source organism Schizosaccharomyces pombe
sequence length 189
total genus Genus: 62
molecule keywords tRNA (guanine(9)-N1)-methyltransferase
ec nomenclature ec 2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.
pdb deposition date 2013-03-27
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling