| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
+31 | 105-149 | 45 | 1-104, 150-193 | 104 | 44 | knot |
Chain Sequence |
HMPRINVNQTDSGIEIILDCSFDELMNDKEIVSLSNQVTRAYSANRRANHFAEIKVAPFDKRLKQRFETTLKNTNYENWNHFKFLPDDKIMFGDEHISKDKIVYLTADTEEKLEKLEPGMRYIVGGIVDKNRYKELCLKKAQKMGIPTRRLPIDEYINLEGRRVLTTTHVVQLMLKYFDDHNWKNAFESVLPP
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
3.1 | 104-151 | 48 | 1-103, 152-193 | 103 | 42 | knot | ||||
| view details |
|
2.1 | 103-146 | 44 | 1-102 | 152-193 | 147-151 | 102 | 42 | slipknot | ||
| view details |
|
3.1 | 105-151 | 47 | 152-193 | 1-103 | 104-104 | 103 | 41 | slipknot | ||
| view details |
|
2.1 | 106-165 | 60 | 1-104, 170-193 | 105-105, 166-169 | 104 | 24 | slipknot | |||
| view details |
|
2.1 | 107-170 | 64 | 1-104, 183-193 | 105-106, 171-182 | 104 | 11 | slipknot |
| sequence length |
193
|
| structure length |
193
|
| publication title |
Crystal structure of tRNA m1G9 methyltransferase Trm10: insight into the catalytic mechanism and recognition of tRNA substrate.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| molecule keywords |
tRNA (guanine(9)-N1)-methyltransferase
|
| source organism |
Saccharomyces cerevisiae
|
| total genus |
Genus: 66
|
| ec nomenclature |
ec
2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase. |
| pdb deposition date | 2013-03-27 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01746 | tRNA_m1G_MT | tRNA (Guanine-1)-methyltransferase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...