| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 3-c-17-b-45-c-24 | 3-b-17 |
Chain Sequence |
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGV--TYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPD
|
| sequence length |
275
|
| structure length |
273
|
| publication title |
Identification of a New Epitope in uPAR as a Target for the Cancer Therapeutic Monoclonal Antibody ATN-658, a Structural Homolog of the uPAR Binding Integrin CD11b ( alpha M)
pubmed doi rcsb |
| molecule tags |
Immune system
|
| molecule keywords |
Urokinase-type plasminogen activator
|
| source organism |
Homo sapiens
|
| missing residues |
83-84
|
| ec nomenclature | |
| pdb deposition date | 2013-04-08 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
