4K3IC

Crystal structure of the quinol form of methylamine dehydrogenase in complex with the diferrous form of maug, c2 space group
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 1x +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 28-88 61 1-27, 89-98 27 10 knot
Fingerprint Knot forming loop Loop type
K +31
Chain closureThr7 <-> Ser131
... Trp108 <-> Toq57 ... Cys29 <-> Cys61 ... Cys88 <-> Cys23 ... Thr7		 probabilistic
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATAS-VASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
sequence length 125
structure length 124
publication title Structures of MauG in complex with quinol and quinone MADH.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methylamine utilization protein MauG
source organism Paracoccus denitrificans
missing residues 51
total genus Genus: 31
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2013-04-10
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling