Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 39-356 | 318 | 1-38 | 440-486 | 357-439 | 38 | 47 | slipknot |
Chain Sequence |
VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADEHHHH
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
2.1 | 36-354 | 319 | 1-35 | 361-486 | 355-360 | 35 | 126 | slipknot | ||
view details |
![]() |
3.1 | 40-358 | 319 | 1-39 | 437-486 | 359-436 | 39 | 50 | slipknot | ||
view details |
![]() |
2.1 | 36-436 | 401 | 1-35 | 441-486 | 437-440 | 35 | 46 | slipknot |
sequence length |
486
|
structure length |
486
|
publication title |
Crystal structure of rat intestinal alkaline phosphatase - Role of crown domain in mammalian alkaline phosphatases.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
Intestinal-type alkaline phosphatase 1
|
source organism |
Rattus norvegicus
|
total genus |
![]() |
ec nomenclature |
ec
3.1.3.1: Alkaline phosphatase. |
pdb deposition date | 2013-05-03 |
KnotProt deposition date | 2014-08-19 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00245 | Alk_phosphatase | Alkaline phosphatase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...