4L55A

X-ray structure of the adduct between bovine pancreatic ribonuclease and aziru
Cysteine knot
Loop Piercing
view details
40-c-58-b-110-c-95 26-b-84
Chain Sequence
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
sequence length 124
structure length 124
publication title Investigating the ruthenium metalation of proteins: X-ray structure and Raman microspectroscopy of the complex between RNase A and AziRu.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ribonuclease pancreatic
ec nomenclature ec 3.1.27.5: Pancreatic ribonuclease.
pdb deposition date 2013-06-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling