| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 7-327 | 321 | 1-6 | 343-391 | 328-342 | 6 | 49 | slipknot |
Chain Sequence |
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDTMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
 |
3.1 | 8-329 | 322 | 1-7 | 338-391 | 330-337 | 7 | 54 | slipknot | |
| view details |
|
 |
2.1 | 5-340 | 336 | 1-4 | 346-391 | 341-345 | 4 | 46 | slipknot |
| sequence length |
391
|
| structure length |
391
|
| publication title |
Bioretrosynthetic construction of a didanosine biosynthetic pathway.
pubmed doi rcsb |
| molecule tags |
Isomerase
|
| molecule keywords |
Phosphopentomutase
|
| source organism |
Bacillus cereus
|
| total genus |
 Genus: 139
|
| ec nomenclature |
ec
5.4.2.7: Phosphopentomutase. |
| pdb deposition date | 2013-07-19 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01676 | Metalloenzyme | Metalloenzyme superfamily |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
