
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
-31 | 8-99 | 92 | 1-7, 100-107 | 7 | 8 | knot |
Chain Sequence |
SMLPNRMALSRQTEDQLKKLKGYTGITPNIAARLAFFRSVESEFRYSPERDSKKLDGTLVLDKITWLGETLQATELVLKMLYPQLEQKALIKAWAAHVEDGIAALRN
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1m | 8-104 | 97 | 1-5, 107-107 | 6-7, 105-106 | 5 | 1 | slipknot |
sequence length |
107
|
structure length |
107
|
publication title |
Structural insights into DndE from Escherichia coli B7A involved in DNA phosphorothioation modification
pubmed doi rcsb |
molecule tags |
Dna binding protein
|
molecule keywords |
DNA sulfur modification protein DndE
|
source organism |
Escherichia coli
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2013-07-21 |
KnotProt deposition date | 2014-07-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08870 | DUF1832 | Domain of unknown function (DUF1832) |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...