4LRVA

Crystal structure of dnde from escherichia coli b7a involved in dna phosphorothioation modification
Knot K -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 8-99 92 1-7, 100-107 7 8 knot
Chain Sequence
SMLPNRMALSRQTEDQLKKLKGYTGITPNIAARLAFFRSVESEFRYSPERDSKKLDGTLVLDKITWLGETLQATELVLKMLYPQLEQKALIKAWAAHVEDGIAALRN
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 8-104 97 1-5, 107-107 6-7, 105-106 5 1 slipknot
publication title Structural insights into DndE from Escherichia coli B7A involved in DNA phosphorothioation modification
pubmed doi rcsb
structure length 107
molecule tags Dna binding protein
source organism Escherichia coli
sequence length 107
total genus Genus: 31
molecule keywords DNA sulfur modification protein DndE
ec nomenclature
pdb deposition date 2013-07-21
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08870 DUF1832 Domain of unknown function (DUF1832)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling