| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 26-255 | 230 | 1-25, 256-265 | 25 | 10 | knot |
Chain Sequence |
HWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYT
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 25-254 | 230 | 1-24, 255-265 | 24 | 11 | knot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | His4 ... His94 <-> Bridging ionZn301 <-> His96 ... Thr268 <-> His4 |
probabilistic | |||
|
|
K +31 | His4 ... His96 <-> Bridging ionZn301 <-> His119 ... Thr268 <-> His4 |
probabilistic | |||
|
|
K +31 | His4 ... His94 <-> Bridging ionZn301 <-> His119 ... Thr268 <-> His4 |
probabilistic |
Chain Sequence |
HWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYT
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 26-256 | 231 | 1-25, 257-266 | 25 | 10 | knot | ||||
| view details |
 |
2.1 | 24-253 | 230 | 1-23 | 259-266 | 254-258 | 23 | 8 | slipknot |
| sequence length |
266
|
| structure length |
266
|
| publication title |
The structural comparison between membrane-associated human carbonic anhydrases provides insights into drug design of selective inhibitors.
pubmed doi rcsb |
| molecule tags |
Lyase/lyase inhibitor
|
| molecule keywords |
Carbonic anhydrase 14
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 78
|
| ec nomenclature |
ec
4.2.1.1: Carbonate dehydratase. |
| pdb deposition date | 2013-07-24 |
| KnotProt deposition date | 2018-10-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
