| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 130-325 | 196 | 326-495 | 1-93 | 94-129 | 93 | 169 | slipknot | ||
| view details |
 |
41 | 91-359 | 269 | 1-90 | 414-495 | 360-413 | 90 | 82 | slipknot |
Chain Sequence |
GIEPKVFFPPLIIVGILCWLTVRDLDASNEVINAVFSYVTNVWGWAFEWYMVIMFGGWFWLVFGRYAKKRLGDEKPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISSPPFGMEGYSAPAKEIGLAYSLFHWGPLPWATYSFLSVAFAYFFFVRKMEVIRPSSTLVPLVGEKHVNGLFGTVVDNFYLVALILAMGTSLGLATPLVTECIQYLFGIPHTLQLDAIIISCWILLNAICVAFGLQKGVKIASDVETYLSFLMLGWVFIVGGASFIVNYFTDSVGTLLMYMPRMLFYTDPIGKGGFPQAWTVFYWAWWVIYAIQMSIFLARISKGRTVRELCLGMVSGLTAGTWLIWTILGGNTLQLIDQNILNIPQLIDQYGVPRAIIETWAALPLSTATMWGFFILCFIATVTLINACSYTLAMSTCRSMKEGADPPLLVRIGWSVLVGIIGIILLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKVHWK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.2 | 51-367 | 317 | 1-50 | 405-495 | 368-404 | 50 | 91 | slipknot | ||
| view details |
 |
4.1 | 78-359 | 282 | 1-2, 402-495 | 3-77, 360-401 | 2 | 94 | slipknot | |||
| view details |
|
4.1 | 78-401 | 324 | 1-2, 407-495 | 3-77, 402-406 | 2 | 89 | slipknot | |||
| view details |
|
3.2 | 52-350 | 299 | 1-6, 360-495 | 7-51, 351-359 | 6 | 136 | slipknot | |||
| view details |
|
3.2 | 37-407 | 371 | 1-18, 421-495 | 19-36, 408-420 | 18 | 75 | slipknot | |||
| view details |
|
3.2 | 40-406 | 367 | 1-20, 417-495 | 21-39, 407-416 | 20 | 79 | slipknot | |||
| view details |
|
3.2 | 40-416 | 377 | 1-36, 421-495 | 37-39, 417-420 | 36 | 75 | slipknot | |||
| view details |
|
3.2 | 54-353 | 300 | 1-51, 360-495 | 52-53, 354-359 | 51 | 136 | slipknot | |||
| view details |
|
3.2 | 89-391 | 303 | 1-71, 412-495 | 72-88, 392-411 | 71 | 84 | slipknot | |||
| view details |
|
3.2 | 87-411 | 325 | 1-71, 413-495 | 72-86, 412-412 | 71 | 83 | slipknot | |||
| view details |
|
4.1 | 91-389 | 299 | 1-77, 408-495 | 78-90, 390-407 | 77 | 88 | slipknot | |||
| view details |
|
4.1 | 91-407 | 317 | 1-88, 412-495 | 89-90, 408-411 | 88 | 84 | slipknot | |||
| view details |
|
4.1 | 94-387 | 294 | 1-77, 406-495 | 78-93, 388-405 | 77 | 90 | slipknot | |||
| view details |
|
3.2 | 94-405 | 312 | 1-90, 408-495 | 91-93, 406-407 | 90 | 88 | slipknot | |||
| view details |
 |
2.1 | 113-415 | 303 | 1-89, 454-495 | 90-112, 416-453 | 89 | 42 | slipknot | |||
| view details |
|
2.1 | 106-482 | 377 | 483-495 | 1-89 | 90-105 | 89 | 12 | slipknot | ||
| view details |
|
2.1 | 124-342 | 219 | 1-104, 358-495 | 105-123, 343-357 | 104 | 138 | slipknot | |||
| view details |
 |
3.1 | 126-327 | 202 | 1-112, 343-495 | 113-125, 328-342 | 112 | 153 | slipknot | |||
| view details |
|
3.1 | 127-419 | 293 | 1-113, 442-495 | 114-126, 420-441 | 113 | 54 | slipknot | |||
| view details |
|
3.1 | 127-483 | 357 | 484-495 | 1-113 | 114-126 | 113 | 11 | slipknot | ||
| view details |
|
2.1 | 136-415 | 280 | 1-116, 461-495 | 117-135, 416-460 | 116 | 35 | slipknot | |||
| view details |
|
2.1 | 136-460 | 325 | 1-116, 468-495 | 117-135, 461-467 | 116 | 28 | slipknot | |||
| view details |
|
2.1 | 136-467 | 332 | 1-116, 482-495 | 117-135, 468-481 | 116 | 14 | slipknot | |||
| view details |
|
2.1 | 137-434 | 298 | 1-135, 459-495 | 136-136, 435-458 | 135 | 37 | slipknot | |||
| view details |
|
2.1 | 137-468 | 332 | 1-135, 479-495 | 136-136, 469-478 | 135 | 17 | slipknot | |||
| view details |
|
2.1 | 136-481 | 346 | 482-495 | 1-124 | 125-135 | 124 | 13 | slipknot | ||
| view details |
 |
1.1 | 138-343 | 206 | 1-124, 359-495 | 125-137, 344-358 | 124 | 137 | slipknot |
| sequence length |
495
|
| structure length |
495
|
| publication title |
Arginine oscillation explains Na+ independence in the substrate/product antiporter CaiT.
pubmed doi rcsb |
| molecule tags |
Transport protein
|
| molecule keywords |
L-carnitine/gamma-butyrobetaine antiporter
|
| source organism |
Proteus mirabilis
|
| total genus |
 Genus: 179
|
| ec nomenclature | |
| pdb deposition date | 2013-08-13 |
| KnotProt deposition date | 2014-08-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02028 | BCCT | BCCT family transporter |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
