Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 87-130 | 44 | 1-86, 131-246 | 86 | 116 | knot |
Chain Sequence |
MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVL---------SFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 86-131 | 46 | 1-85, 132-237 | 85 | 106 | knot |
sequence length |
246
|
structure length |
237
|
publication title |
Selective Inhibitors of Bacterial t-RNA-(N(1)G37) Methyltransferase (TrmD) That Demonstrate Novel Ordering of the Lid Domain.
pubmed doi rcsb |
molecule tags |
Transferase/transferase inhibitor
|
molecule keywords |
tRNA (guanine-N(1)-)-methyltransferase
|
source organism |
Haemophilus influenzae rd kw20
|
missing residues |
161-169
|
total genus |
![]() |
ec nomenclature |
ec
2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase. |
pdb deposition date | 2013-08-21 |
KnotProt deposition date | 2014-07-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01746 | tRNA_m1G_MT | tRNA (Guanine-1)-methyltransferase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...