Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | +31 | 5-253 | 249 | 1-4 | 271-483 | 254-270 | 4 | 213 | slipknot |
Chain Sequence |
PRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSXSPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQPLHNELRS
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
|
3.1 | 5-254 | 250 | 1-4 | 262-483 | 255-261 | 4 | 222 | slipknot | ||
view details |
|
3.1 | 4-261 | 258 | 1-3 | 267-483 | 262-266 | 3 | 217 | slipknot | ||
view details |
|
3.1 | 4-266 | 263 | 1-3 | 270-483 | 267-269 | 3 | 214 | slipknot |
sequence length |
483
|
structure length |
483
|
publication title |
Structure of sulfamidase provides insight into the molecular pathology of mucopolysaccharidosis IIIA
rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
N-sulphoglucosamine sulphohydrolase
|
source organism |
Homo sapiens
|
total genus |
Genus: 167
|
ec nomenclature |
ec
3.10.1.1: N-sulfoglucosamine sulfohydrolase. |
pdb deposition date | 2013-08-30 |
KnotProt deposition date | 2014-08-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00884 | Sulfatase | Sulfatase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...