4MIVE

Crystal structure of sulfamidase, crystal form l
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 7-251 245 1-6 271-483 252-270 6 213 slipknot
Chain Sequence
PRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSXSPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQPLHNELRS
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 4-256 253 1-3 269-483 257-268 3 215 slipknot
view details
3.1 4-268 265 1-3 271-483 269-270 3 213 slipknot
view details
2.1 7-260 254 1-3, 271-483 4-6, 261-270 3 213 slipknot
sequence length 483
structure length 483
publication title Structure of sulfamidase provides insight into the molecular pathology of mucopolysaccharidosis IIIA
rcsb
molecule tags Hydrolase
molecule keywords N-sulphoglucosamine sulphohydrolase
source organism Homo sapiens
ec nomenclature ec 3.10.1.1: N-sulfoglucosamine sulfohydrolase.
pdb deposition date 2013-09-02
KnotProt deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling