Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 7-251 | 245 | 1-6 | 271-483 | 252-270 | 6 | 213 | slipknot |
Chain Sequence |
PRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSXSPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQPLHNELRS
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
|
![]() |
3.1 | 4-256 | 253 | 1-3 | 269-483 | 257-268 | 3 | 215 | slipknot | |
view details |
|
![]() |
3.1 | 4-268 | 265 | 1-3 | 271-483 | 269-270 | 3 | 213 | slipknot | |
view details |
|
![]() |
2.1 | 7-260 | 254 | 1-3, 271-483 | 4-6, 261-270 | 3 | 213 | slipknot |
sequence length |
483
|
structure length |
483
|
publication title |
Structure of sulfamidase provides insight into the molecular pathology of mucopolysaccharidosis IIIA
rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
N-sulphoglucosamine sulphohydrolase
|
source organism |
Homo sapiens
|
ec nomenclature |
ec
3.10.1.1: N-sulfoglucosamine sulfohydrolase. |
pdb deposition date | 2013-09-02 |
KnotProt deposition date | 2014-08-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
E | PF00884 | Sulfatase | Sulfatase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...