Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | +31 | 5-253 | 249 | 1-4 | 273-482 | 254-272 | 4 | 210 | slipknot |
Chain Sequence |
PRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSXSPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQPLHNELR
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
|
3.1 | 4-253 | 250 | 1-3 | 267-482 | 254-266 | 3 | 216 | slipknot | ||
view details |
|
2.1 | 7-262 | 256 | 1-3, 267-482 | 4-6, 263-266 | 3 | 216 | slipknot | |||
view details |
|
2.1 | 7-266 | 260 | 1-2, 270-482 | 3-6, 267-269 | 2 | 213 | slipknot |
sequence length |
482
|
structure length |
482
|
publication title |
Structure of sulfamidase provides insight into the molecular pathology of mucopolysaccharidosis IIIA
rcsb |
molecule tags |
Hydrolase
|
molecule keywords |
N-sulphoglucosamine sulphohydrolase
|
source organism |
Homo sapiens
|
ec nomenclature |
ec
3.10.1.1: N-sulfoglucosamine sulfohydrolase. |
pdb deposition date | 2013-09-02 |
KnotProt deposition date | 2014-08-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
H | PF00884 | Sulfatase | Sulfatase |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...