4MM5A

Crystal structure of leubat (delta13 mutant) in complex with sertraline
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 197
Slipknot S +31 41 +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 37-264 228 265-507 1-21 22-36 21 242 slipknot
view details
41 13-297 285 1-12 349-507 298-348 12 159 slipknot
Chain Sequence
REHWATRLGLILAMAGYAVDLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVASYYVYIESWTLGFAIKFLVGLVPEPP---TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKLKDPGVWIAAVGQIFFSLGLGFGVLITFASYVRKDQDIVLSGLTAATLNEKASVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAGMQGMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWATGIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYTHW-------TVWITRFYIIGLFLFLTFLVFLAERRRNHE
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 10-287 278 1-9 300-497 288-299 9 198 slipknot
view details
4.1 11-298 288 1-10 309-497 299-308 10 189 slipknot
view details
3.2m 11-313 303 1-10 322-497 314-321 10 176 slipknot
view details
3.2 7-322 316 1-6 328-497 323-327 6 170 slipknot
view details
3.2 14-334 321 1-13 348-497 335-347 13 150 slipknot
view details
4.1 12-298 287 1-10, 309-497 11-11, 299-308 10 189 slipknot
view details
2.1 41-404 364 405-497 1-15 16-40 15 92 slipknot
view details
2.1 40-353 314 1-16, 401-497 17-39, 354-400 16 97 slipknot
view details
3.1 30-255 226 1-19, 267-497 20-29, 256-266 19 231 slipknot
view details
1.1 38-242 205 1-20, 254-497 21-37, 243-253 20 244 slipknot
view details
1.1 30-253 224 1-21, 256-497 22-29, 254-255 21 242 slipknot
view details
1.1 41-278 238 1-25, 293-497 26-40, 279-292 25 205 slipknot
view details
2.1 36-272 237 1-26, 279-497 27-35, 273-278 26 219 slipknot
view details
1.1 36-253 218 1-29, 257-497 30-35, 254-256 29 241 slipknot
view details
1.1 38-271 234 1-27, 279-497 28-37, 272-278 27 219 slipknot
view details
1.1 41-271 231 1-37, 279-497 38-40, 272-278 37 219 slipknot
view details
3.1 38-258 221 1-29, 271-497 30-37, 259-270 29 227 slipknot
sequence length 507
structure length 497
publication title Structural basis for action by diverse antidepressants on biogenic amine transporters.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Transporter
source organism Aquifex aeolicus
missing residues 128-130, 468-474
total genus Genus: 197
ec nomenclature
pdb deposition date 2013-09-08
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00209 SNF Sodium:neurotransmitter symporter family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling