4MM7A

Crystal structure of leubat (delta13 mutant) in complex with desvenlafaxine
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 204
Slipknot S +31 41 +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 37-264 228 265-507 1-20 21-36 20 242 slipknot
view details
41 13-294 282 1-12 349-507 295-348 12 159 slipknot
Chain Sequence
REHWATRLGLILAMAGYAVDLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVASYYVYIESWTLGFAIKFLVGLVPEPP---TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKLKDPGVWIAAVGQIFFSLGLGFGVLITFASYVRKDQDIVLSGLTAATLNEKASVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAGMQGMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWATGIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYIPTHW-----TVWITRFYIIGLFLFLTFLVFLAERRRNHE
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 10-286 277 1-9 300-499 287-299 9 200 slipknot
view details
4.1 12-299 288 1-11 307-499 300-306 11 193 slipknot
view details
4.1 6-310 305 1-5 321-499 311-320 5 179 slipknot
view details
4.1 17-331 315 1-16 345-499 332-344 16 155 slipknot
view details
3.2 15-325 311 1-8, 330-499 9-14, 326-329 8 170 slipknot
view details
3.2 13-329 317 1-8, 331-499 9-12, 330-330 8 169 slipknot
view details
1.1 20-277 258 1-15, 285-499 16-19, 278-284 15 215 slipknot
view details
1.1 25-275 251 1-16, 288-499 17-24, 276-287 16 212 slipknot
view details
1.1 40-259 220 1-17, 273-499 18-39, 260-272 17 227 slipknot
view details
2.1 40-352 313 1-18, 398-499 19-39, 353-397 18 102 slipknot
view details
1.1 37-241 205 1-23, 259-499 24-36, 242-258 23 241 slipknot
view details
1.1 41-273 233 1-25, 293-499 26-40, 274-292 25 207 slipknot
view details
2.1 37-398 362 1-30, 405-499 31-36, 399-404 30 95 slipknot
sequence length 507
structure length 499
publication title Structural basis for action by diverse antidepressants on biogenic amine transporters.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Transporter
source organism Aquifex aeolicus
missing residues 128-130, 470-474
total genus Genus: 204
ec nomenclature
pdb deposition date 2013-09-08
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00209 SNF Sodium:neurotransmitter symporter family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling