4MM9A

Crystal structure of leubat (delta13 mutant) in complex with fluvoxamine
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 41 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 206
Slipknot S +31 41 +31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 37-264 228 265-507 1-21 22-36 21 242 slipknot
view details
41 13-297 285 1-12 349-507 298-348 12 159 slipknot
Chain Sequence
REHWATRLGLILAMAGYAVDLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFYLLWRNRFAKILGVFGLWIPLVVASYYVYIESWTLGFAIKFLVGLVPEPP---TDPDSILRPFKEFLYSYIGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKLKDPGVWIAAVGQIFFSLGLGFGVLITFASYVRKDQDIVLSGLTAATLNEKASVILGGSISIPAAVAFFGVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAGMQGMIAFLEDELKLSRKHAVLWTAAIVFFSAHLVMFLNKSLDEMDFWATGIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLLVVWAREYIPKHWT-----VWITRFYIIGLFLFLTFLVFLAERRRNHE
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.2 11-286 276 1-10 300-499 287-299 10 200 slipknot
view details
4.1 10-299 290 1-9 307-499 300-306 9 193 slipknot
view details
4.1 10-306 297 1-9 312-499 307-311 9 188 slipknot
view details
3.2 8-311 304 1-7 315-499 312-314 7 185 slipknot
view details
3.2 17-331 315 1-16 347-499 332-346 16 153 slipknot
view details
3.2 11-300 290 1-9, 311-499 10-10, 301-310 9 189 slipknot
view details
2.1 41-411 371 412-499 1-16 17-40 16 87 slipknot
view details
2.1 40-397 358 1-17, 412-499 18-39, 398-411 17 88 slipknot
view details
1.1 33-255 223 1-18, 264-499 19-32, 256-263 18 236 slipknot
view details
2.1 33-263 231 1-18, 272-499 19-32, 264-271 18 228 slipknot
view details
2.1 33-271 239 1-18, 273-499 19-32, 272-272 18 227 slipknot
view details
2.1 41-351 311 1-19, 366-499 20-40, 352-365 19 134 slipknot
view details
1.1 29-243 215 1-22, 256-499 23-28, 244-255 22 244 slipknot
view details
1.1 38-242 205 1-24, 257-499 25-37, 243-256 24 243 slipknot
view details
1.1 41-276 236 1-25, 291-499 26-40, 277-290 25 209 slipknot
view details
1.1 40-290 251 1-26, 292-499 27-39, 291-291 26 208 slipknot
view details
1.1 41-274 234 1-26, 277-499 27-40, 275-276 26 223 slipknot
view details
1.1 38-269 232 1-28, 275-499 29-37, 270-274 28 225 slipknot
view details
2.1 40-261 222 1-33, 270-499 34-39, 262-269 33 230 slipknot
sequence length 507
structure length 499
publication title Structural basis for action by diverse antidepressants on biogenic amine transporters.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Transporter
source organism Aquifex aeolicus
missing residues 128-130, 471-475
total genus Genus: 206
ec nomenclature
pdb deposition date 2013-09-08
KnotProt deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00209 SNF Sodium:neurotransmitter symporter family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling