| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 37-c-41-b-109-c-107 | 8-b-74 |
Chain Sequence |
AGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR
|
| sequence length |
107
|
| structure length |
107
|
| publication title |
Regulation of Bone Morphogenetic Protein 9 (BMP9) by Redox-dependent Proteolysis.
pubmed doi rcsb |
| molecule tags |
Cytokine
|
| molecule keywords |
Growth/differentiation factor 2
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2013-09-13 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
