4MQWA

Structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor (p31)
Cysteine knot
Loop Piercing
view details
28-c-32-b-84-c-82 10-b-60
Chain Sequence
QDCPECTLQENPLFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
sequence length 88
structure length 88
publication title Evidence for Follicle-stimulating Hormone Receptor as a Functional Trimer.
pubmed doi rcsb
molecule tags Signaling protein
molecule keywords Glycoprotein hormones, alpha polypeptide
source organism Homo sapiens
ec nomenclature
pdb deposition date 2013-09-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling