| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 28-c-32-b-84-c-82 | 10-b-60 |
Chain Sequence |
QDCPECTLQENPLFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
|
| sequence length |
88
|
| structure length |
88
|
| publication title |
Evidence for Follicle-stimulating Hormone Receptor as a Functional Trimer.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Glycoprotein hormones, alpha polypeptide
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2013-09-16 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
