4N4CA

Crystal structure of the c-terminal swapped dimer of a bovine seminal ribonuclease mutant
Cysteine knot
Loop Piercing
view details
40-c-58-b-110-c-95 26-b-84
Chain Sequence
KESAAAKFERQHMDSSTSAASSSNYCNLMMR--KMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMRITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHFDASV
sequence length 124
structure length 122
publication title The multiple forms of bovine seminal ribonuclease: Structure and stability of a C-terminal swapped dimer.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Seminal ribonuclease
source organism Bos taurus
missing residues 31-32
ec nomenclature ec 3.1.27.5: Pancreatic ribonuclease.
pdb deposition date 2013-10-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling