Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | +31 | 17-268 | 252 | 1-16, 269-386 | 16 | 118 | knot |
Chain Sequence |
EQFLFSSESVCSGHPDKLCDQISDAILDACLEQDPESFVACETCTKTGFIMVFGEITTKANVNYERVVRETVKEIGYDSEEKGLDYKTMDVIIKLEQQSNQIAGCVHVDKNVEDIGAGDQGMMFGYATNETKELMPLTHVLATSITRELDYIRMKGVSSRVGWLRPDGKAQVTVEYNCKHGVLIPKRIHTILVSVQHDENIENEEIREFVLENVIKKVCPSDLMDKETRILINPSGRFTIGGPAADAGLTGRKIIVDTYGGWGAHGGGAFSGKDATKVDRSGAYMARLVAKSIVFSGLCSRCLVQVSYGIGIARPLSLYINTFGTAKDGYNDTKLLEIVNKVFDFRPGILIKQLNLKSPIFKKTSSGGHFGRSEKEFLWEKPIILQ
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | 2.1 | 20-285 | 266 | 1-4, 356-386 | 5-19, 286-355 | 4 | 31 | slipknot | ||||
view details | 1.1 | 18-250 | 233 | 1-5, 261-386 | 6-17, 251-260 | 5 | 126 | slipknot | ||||
view details | 1.1 | 15-260 | 246 | 1-6, 262-386 | 7-14, 261-261 | 6 | 125 | slipknot | ||||
view details | 1.1 | 17-360 | 344 | 1-5, 371-386 | 6-16, 361-370 | 5 | 16 | slipknot | ||||
view details | 2.1 | 19-370 | 352 | 1-5, 385-386 | 6-18, 371-384 | 5 | 2 | slipknot |
sequence length |
386
|
structure length |
386
|
publication title |
Crystal structure of a putative S-adenosylmethionine synthetase from Cryptosporidium hominis in complex with S-adenosyl-methionine
rcsb |
molecule tags |
Transferase
|
molecule keywords |
S-adenosylmethionine synthase
|
source organism |
Cryptosporidium hominis
|
total genus |
Genus: 135
|
ec nomenclature |
ec
2.5.1.6: Methionine adenosyltransferase. |
pdb deposition date | 2014-01-10 |
KnotProt deposition date | 2014-07-31 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00438 | S-AdoMet_synt_N | S-adenosylmethionine synthetase, N-terminal domain |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...