4ODJA

Crystal structure of a putative s-adenosylmethionine synthetase from cryptosporidium hominis in complex with s-adenosyl-methionine
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 17-268 252 1-16, 269-386 16 118 knot
Chain Sequence
EQFLFSSESVCSGHPDKLCDQISDAILDACLEQDPESFVACETCTKTGFIMVFGEITTKANVNYERVVRETVKEIGYDSEEKGLDYKTMDVIIKLEQQSNQIAGCVHVDKNVEDIGAGDQGMMFGYATNETKELMPLTHVLATSITRELDYIRMKGVSSRVGWLRPDGKAQVTVEYNCKHGVLIPKRIHTILVSVQHDENIENEEIREFVLENVIKKVCPSDLMDKETRILINPSGRFTIGGPAADAGLTGRKIIVDTYGGWGAHGGGAFSGKDATKVDRSGAYMARLVAKSIVFSGLCSRCLVQVSYGIGIARPLSLYINTFGTAKDGYNDTKLLEIVNKVFDFRPGILIKQLNLKSPIFKKTSSGGHFGRSEKEFLWEKPIILQ
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 20-285 266 1-4, 356-386 5-19, 286-355 4 31 slipknot
view details
1.1 18-250 233 1-5, 261-386 6-17, 251-260 5 126 slipknot
view details
1.1 15-260 246 1-6, 262-386 7-14, 261-261 6 125 slipknot
view details
1.1 17-360 344 1-5, 371-386 6-16, 361-370 5 16 slipknot
view details
2.1 19-370 352 1-5, 385-386 6-18, 371-384 5 2 slipknot
publication title Crystal structure of a putative S-adenosylmethionine synthetase from Cryptosporidium hominis in complex with S-adenosyl-methionine
rcsb
structure length 386
molecule tags Transferase
source organism Cryptosporidium hominis
sequence length 386
total genus Genus: 135
molecule keywords S-adenosylmethionine synthase
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2014-01-10
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling