| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 25-c-27-b-30-c-30 | 25-b-27 |
Chain Sequence |
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGR
|
| sequence length |
49
|
| structure length |
49
|
| publication title |
AFF4 binding to Tat-P-TEFb indirectly stimulates TAR recognition of super elongation complexes at the HIV promoter.
pubmed doi rcsb |
| molecule tags |
Transferase/viral protein
|
| molecule keywords |
Cyclin-dependent kinase 9
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2014-01-16 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
