4OT4A

X-ray structure of the adduct formed between cisplatin and ribonuclease a
Cysteine knot
Loop Piercing
view details
40-c-58-b-110-c-95 26-b-84
Chain Sequence
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
sequence length 124
structure length 124
publication title Cisplatin binding to proteins: molecular structure of the ribonuclease a adduct.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ribonuclease pancreatic
source organism Bos taurus
ec nomenclature ec 3.1.27.5: Pancreatic ribonuclease.
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling