4PQ7A

The crystal structure of the human carbonic anhydrase ii in complex with a sulfamide inhibitor
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 20-259 240 260-261 1-2 3-19 2 1 slipknot
Chain Sequence
GMSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 3x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 25-258 234 259-261 1-10 11-24 10 2 slipknot
Fingerprint Knot forming loop Loop type
K +31
Chain closureGly0 <-> Phe260
... His96 <->
Bridging ionZn301
<-> His94 ... Gly0
probabilistic
K +31 Gly0 ... His96 <->
Bridging ionZn301
<-> His119 ...
Chain closurePhe260 <-> Gly0
probabilistic
K +31 Gly0 ... His94 <->
Bridging ionZn301
<-> His119 ...
Chain closurePhe260 <-> Gly0
probabilistic
Chain Sequence
GMSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 28-255 228 1-27, 256-260 27 5 knot
sequence length 260
structure length 260
publication title Hydrophobic substituents of the phenylmethylsulfamide moiety can be used for the development of new selective carbonic anhydrase inhibitors.
pubmed doi rcsb
molecule tags Lyase/lyase inhibitor
molecule keywords Carbonic anhydrase 2
source organism Homo sapiens
total genus Genus: 77
ec nomenclature ec 4.2.1.1: Carbonate dehydratase.
pdb deposition date 2014-02-28
KnotProt deposition date 2018-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
4XE1A 5E2RA 5J8ZA 5JQ0A 5JQTA 5LMDA 5N0DA 5N0EA 6H2ZA
similar chains in the KnotProt database (40% sequence similarity)
None
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)
4XE1 A; 5E2R A; 5J8Z A; 5JQ0 A; 5JQT A; 5LMD A; 5N0D A; 5N0E A; 6H2Z A; 
#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)


KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.