4PZKA

Crystal strucrure of putative rna methyltransferase from bacillus anthracis.
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 78-121 44 1-77, 122-159 77 38 knot
Chain Sequence
GVHVVLYQPEIPANTGNIARTCAATGTELHLIRPLGFSTDDKMLKRAGLDYWQHVKITYYDSIEEFYEKNKDGEFFYLTKYGEKAHTAFDYSKREKDYYFVFGRETNGLPANVIEENFDHCLRIPMTDKVRSLNLSNTAAILIYEAFRQQNYPGLDLEI
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 77-123 47 1-76, 124-159 76 36 knot
view details
2.1 76-119 44 1-75 125-159 120-124 75 35 slipknot
view details
3.1 80-139 60 140-159 1-76 77-79 76 19 slipknot
sequence length 159
structure length 159
publication title Crystal strucrure of putative RNA methyltransferase from Bacillus anthracis.
rcsb
molecule tags Transferase
molecule keywords tRNA (cytidine(34)-2'-O)-methyltransferase
source organism Bacillus anthracis
total genus Genus: 54
ec nomenclature ec 2.1.1.207: tRNA (cytidine(34)-2'-O)-methyltransferase.
pdb deposition date 2014-03-31
KnotProt deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00588 SpoU_methylase SpoU rRNA Methylase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.