| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 49-c-53-b-99-c-97 | 16-b-60 |
Chain Sequence |
PAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCET
|
| sequence length |
92
|
| structure length |
92
|
| publication title |
Characterization of Binding Mode of Action of a Blocking Anti-Platelet-Derived Growth Factor (PDGF)-B Monoclonal Antibody, MOR8457, Reveals Conformational Flexibility and Avidity Needed for PDGF-BB To Bind PDGF Receptor-beta.
pubmed doi rcsb |
| molecule tags |
Cytokine/cytokine receptor
|
| molecule keywords |
anti-PDGF-BB antibody - Light Chain
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2014-05-12 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
