4QFJA

The crystal structure of rat angiogenin-heparin complex
Cysteine knot
Loop Piercing
view details
39-c-57-b-106-c-91 26-b-80
Chain Sequence
DPRYTKFLTQHYDAKPKGRDARYCESMMRRRGLTSPCKEVNTFIHGNKGSIKAICGANGSPYN--LRISQSPFQITTCKHTGGSPRPPCRYRASAGFRHVVIACENGLPVHFDESF
sequence length 116
structure length 114
publication title The crystal structure of rat angiogenin-heparin complex
rcsb
molecule tags Hydrolase
molecule keywords Angiogenin
source organism Rattus norvegicus
missing residues 63-64
ec nomenclature
pdb deposition date 2014-05-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling