| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 22-245 | 224 | 1-21, 246-247 | 21 | 2 | knot |
Chain Sequence |
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLMVDNWRPAQPLKNRQIKASFK
|
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
+ 31 | 20-243 | 224 | 1-19, 244-247 | 19 | 3 | slipknot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | His4 ... His94 <-> Bridging ionZn301 <-> His96 ... Chain closureLys250 <-> His4 |
probabilistic | |||
|
|
K +31 | His4 ... His96 <-> Bridging ionZn301 <-> His119 ... Chain closureLys250 <-> His4 |
probabilistic | |||
|
|
K +31 | His4 ... His94 <-> Bridging ionZn301 <-> His119 ... Chain closureLys250 <-> His4 |
probabilistic |
Chain Sequence |
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLMVDNWRPAQPLKNRQIKASFK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 26-244 | 219 | 1-25, 245-246 | 25 | 2 | knot | ||||
| view details |
 |
2.1 | 25-240 | 216 | 1-24 | 245-246 | 241-244 | 24 | 2 | slipknot |
| sequence length |
246
|
| structure length |
246
|
| publication title |
Structural and catalytic effects of proline substitution and surface loop deletion in the extended active site of human carbonic anhydrase II.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Carbonic anhydrase 2
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 68
|
| ec nomenclature |
ec
4.2.1.1: Carbonic anhydrase. |
| pdb deposition date | 2014-06-05 |
| KnotProt deposition date | 2018-10-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00194 | Carb_anhydrase | Eukaryotic-type carbonic anhydrase |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
