| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 106-219 | 114 | 1-96, 227-236 | 97-105, 220-226 | 96 | 10 | slipknot |
Chain Sequence |
DSIDDKKWSKLFPRIVSDPDRSSNFMTRAIYVAFSAVLRNRNILGQEYFTKNYITEKLKCMTLCFRNLRSNQIAQLLRNAGDATKDGFLKEVSLVITNNEGDLEAIEVFSMKFIYFENGGVVARLSTDKNGQEDPHFAKLAQLVYEGGDSVRDQMVTIVRSVQFLCTKVLEPLPEEFTANFRLEYTNDAPSNFRIDGFEDSSTFYTLPDDIQSATIGHLRPGCHAANMECWSMLMS
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
2.1 | 108-215 | 108 | 1-95, 231-236 | 96-107, 216-230 | 95 | 6 | slipknot |
| sequence length |
236
|
| structure length |
236
|
| publication title |
The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.
pubmed doi rcsb |
| molecule tags |
Peptide binding protein
|
| molecule keywords |
Protein HTP-1
|
| source organism |
Caenorhabditis elegans
|
| total genus |
 Genus: 65
|
| ec nomenclature | |
| pdb deposition date | 2014-07-10 |
| KnotProt deposition date | 2015-02-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02301 | HORMA | HORMA domain |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
