4TZOA

Structure of c. elegans htp-1 bound to him-3 closure motif
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 106-219 114 1-96, 227-236 97-105, 220-226 96 10 slipknot
Chain Sequence
DSIDDKKWSKLFPRIVSDPDRSSNFMTRAIYVAFSAVLRNRNILGQEYFTKNYITEKLKCMTLCFRNLRSNQIAQLLRNAGDATKDGFLKEVSLVITNNEGDLEAIEVFSMKFIYFENGGVVARLSTDKNGQEDPHFAKLAQLVYEGGDSVRDQMVTIVRSVQFLCTKVLEPLPEEFTANFRLEYTNDAPSNFRIDGFEDSSTFYTLPDDIQSATIGHLRPGCHAANMECWSMLMS
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 108-215 108 1-95, 231-236 96-107, 216-230 95 6 slipknot
publication title The Chromosome Axis Controls Meiotic Events through a Hierarchical Assembly of HORMA Domain Proteins.
pubmed doi rcsb
structure length 236
molecule tags Peptide binding protein
source organism Caenorhabditis elegans
sequence length 236
total genus Genus: 65
molecule keywords Protein HTP-1
ec nomenclature
pdb deposition date 2014-07-10
KnotProt deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02301 HORMA HORMA domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling