4UORA

Structure of lipoteichoic acid synthase ltas from listeria monocytogenes in complex with glycerol phosphate
Slipknot S +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 33-255 223 1-32 287-418 256-286 32 132 slipknot
Chain Sequence
SSDVTEVLNYTKSKYAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDQNTLSFTNFFHQTGQGKTADSEMLLENSLYGLPQGSAFTTKGQNTYESASAILGQQGYTSAVFHGNYKSFWNRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLQQPFYTKFITLTNHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYGDHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIHVPGVQGGVQEQYGGQVDLLPTLLHLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITPTYSMIGGNMYNQQTGEPIATETKEMKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKVDPSKYNYNK
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1 20-253 234 1-19 260-418 254-259 19 159 slipknot
view details
3.1 33-255 223 1-32 284-418 256-283 32 135 slipknot
view details
3.1 33-283 251 1-32 287-418 284-286 32 132 slipknot
view details
3.1 13-286 274 1-3, 289-418 4-12, 287-288 3 130 slipknot
view details
2.1 21-286 266 1-13, 289-418 14-20, 287-288 13 130 slipknot
view details
2.1 35-274 240 1-32, 283-418 33-34, 275-282 32 136 slipknot
sequence length 418
structure length 418
publication title Structural and Mechanistic Insight Into the Listeria Monocytogenes Two-Enzyme Lipoteichoic Acid Synthesis System
pubmed doi rcsb
molecule tags Transferase
molecule keywords LIPOTEICHOIC ACID SYNTHASE
source organism Listeria monocytogenes egd-e
total genus Genus: 168
ec nomenclature ec 2.7.8.-:
pdb deposition date 2014-06-09
KnotProt deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.