4V1Aw

Structure of the large subunit of the mammalian mitoribosome, part 2 of 2
Knot K -31 -31 -31 -31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 187-250 64 1-186, 251-387 186 137 knot
Chain Sequence
PVARYPPIVASLTAKSKAARQRRVEQWQATVHAAKSVDEKLRILTKMQFMKYVVYPQTFALNADNWYQSFTKTVFLSGLPPTPAKLEPEPTLDITALREAVCDCLLQEHFFLRRKKRAPVIQDREAIASPFLDQLVASLTGLLSVHNPVLAAAALDCKRPVHFFWLRGEEIIPRGHRKGRVDALRYQINDKPHNQIRISRQLPEFVPLDYSIPIEVPVMSCKPDKLPLFKRQYENTIFIGSKTADPLCYGHTQFHLLPDKLKREKLLKQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQGVITDGKYFSFFCYQLNTLALTAQADQNNPRKNICWGTQSKPLYETIEDNNVKGFNDDVLLQLVQFLLNRPKED
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
2.1m 52-373 322 1-51 386-387 374-385 51 2 slipknot
view details
3.1m 184-253 70 1-165, 273-387 166-183, 254-272 165 115 slipknot
view details
3.1m 184-272 89 1-165, 282-387 166-183, 273-281 165 106 slipknot
view details
3.1m 186-313 128 1-165, 326-387 166-185, 314-325 165 62 slipknot
view details
2.1m 185-277 93 1-166, 293-387 167-184, 278-292 166 95 slipknot
view details
2.1m 183-292 110 1-167, 295-387 168-182, 293-294 167 93 slipknot
view details
3.1m 185-348 164 349-387 1-166 167-184 166 38 slipknot
view details
3.1m 186-350 165 351-387 1-184 185-185 184 36 slipknot
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
doi rcsb
structure length 387
molecule tags Ribosome
sequence length 387
total genus Genus: 90
molecule keywords MITORIBOSOMAL PROTEIN ML37, MRPL37
ec nomenclature
pdb deposition date 2014-09-25
KnotProt deposition date 2014-10-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling