4WYZA

The crystal structure of the a109g mutant of rnase a in complex with 3'ump
Cysteine knot
Loop Piercing
view details
40-c-58-b-110-c-95 26-b-84
Chain Sequence
MKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVGCEGNPYVPVHFDASV
sequence length 125
structure length 125
publication title Perturbation of the Conformational Dynamics of an Active-Site Loop Alters Enzyme Activity.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ribonuclease pancreatic
source organism Bos taurus
ec nomenclature ec 3.1.27.5: Pancreatic ribonuclease.
pdb deposition date 2014-11-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling