
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 78-130 | 53 | 1-77, 131-238 | 77 | 108 | knot |
Chain Sequence |
MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQ----------TPYPLVDDLERFYGHLEQTLLATGFIRENHPGQVMNKLRRLFTRARPESQELNILRGILASIEQ
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 78-131 | 54 | 1-77, 132-228 | 77 | 97 | knot |
sequence length |
238
|
structure length |
228
|
publication title |
tRNA recognition by a bacterial tRNA Xm32 modification enzyme from the SPOUT methyltransferase superfamily
pubmed doi rcsb |
molecule tags |
Transferase
|
molecule keywords |
tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ
|
source organism |
Escherichia coli k12
|
missing residues |
165-174
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2014-12-17 |
KnotProt deposition date | 2015-12-23 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...